A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10013
Swiss-prot Accession number	P01176 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1] (Fragment).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	105 Amino acids
Molecular weight	10723
References	1  PubMed abstract 13629241 2  PubMed abstract 10343920 3  PubMed abstract 7271775
Domain Name	Hormone_5
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (1-9)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10029
Swiss-prot Accession number	P01226 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14387
References	1  PubMed abstract 11717129 2  PubMed abstract 670202 3  PubMed abstract 11717129 4  PubMed abstract 670202
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	NSCELTNITIAVEKEECGFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATACHCGKCNSDSTDCTVRGLGPSYCSFGDMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	P47799    Detail in HMRbase
Gene ID	100033829
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	10057
Swiss-prot Accession number	Q27IM2 (Sequence in FASTA format)
Description	Parathyroid hormone precursor (Parathyrin) (PTH).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the parathyroid hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Protein Length	115 Amino acids
Molecular weight	13062
References	1   Rourke K.M., Kohn C.W., Rosol T.J., Toribio R.E.; Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2   Shiue Y.-L., Caetano A.R., Lyons L.A., O'Brien S.J., Laughlin T.F.,Murray J.D., Bowling A.T.; Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Parathyroid
Hormone Name	Parathyroid hormone (Parathyrin) (PTH)
Mature Hormone Sequence	SVSEIQLMHNLGKHLNSVERVEWLRKKLQDVHNFIALGAPIFHRDGGSQRPRKKEDNVLIESHQKSLGEADKADVDVLSKTKSQ
Position of mature hormone in Pre-Hormone protein	84 Residues from position (32-115)
Receptor	N/A
Gene ID	100034104
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10166
Swiss-prot Accession number	Q28376 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15663
References	1   Kania S.A., Olchowy T.W., Frank L.A.; Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPDHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKANYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	N/A
Gene ID	100034188
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10231
Swiss-prot Accession number	Q9N0V5 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	140 Amino acids
Molecular weight	15358
References	1  PubMed abstract 12581884
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLGTYTQDLNKFHTFPQTAIGVGAP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (84-115)
Receptor	N/A
Gene ID	100033906
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10639
Swiss-prot Accession number	P08751 (Sequence in FASTA format)
Description	Lutropin/choriogonadotropin subunit beta precursor (LSH-B/CG-B)(Luteinizing hormone subunit beta) (Lutropin/choriogonadotropin betachain).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	Microheterogeneity at Asn-33. O-glycosylation appears to be responsible for the beta subunit contribution to the difference in LH-receptor binding activity between LSH-B and CG-B.
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	169 Amino acids
Molecular weight	17865
References	1  PubMed abstract 1379674 2  PubMed abstract 3298239 3  PubMed abstract 3298238 4   Ward D.N., Moore W.T. Jr., Burleigh B.D.; "Structural studies on equine chorionic gonadotropin."; J. Protein Chem. 1:263-280(1982). 5  PubMed abstract 2331995 6  PubMed abstract 11133668
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCPSMVRVMPAALPAIPQPVCTYRELRFASIRLPGCPPGVDPMVSFPVALSCHCGPCQIKTTDCGVFRDQPLACAPQASSSSKDPPSQPLTSTSTPTPGASRRSSHPLPIKTS
Position of mature hormone in Pre-Hormone protein	149 Residues from position (21-169)
Receptor	N/A
Gene ID	100054774
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10739
Swiss-prot Accession number	P01245 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24423
References	1  PubMed abstract 8206392 2  PubMed abstract 965151 3  PubMed abstract 4747849 4  PubMed abstract 11946725 5  PubMed abstract 4876100
Domain Name	Hormone_1
Hormone Name	Growth hormone (Somatotropin) (GH)
Mature Hormone Sequence	FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVFGTSDRVYEKLRDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	N/A
Gene ID	100034180
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10840
Swiss-prot Accession number	P01310 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9147
References	1  PubMed abstract 13373434 2  PubMed abstract 4640931
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10841
Swiss-prot Accession number	P01310 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9147
References	1  PubMed abstract 13373434 2  PubMed abstract 4640931
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTGICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (66-86)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	11014
Swiss-prot Accession number	P12420 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	229 Amino acids
Molecular weight	26256
References	1  PubMed abstract 12742553 2  PubMed abstract 3045032
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (31-229)
Receptor	N/A
Gene ID	100034034
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	11047
Swiss-prot Accession number	P63314 (Sequence in FASTA format)
Description	Thymosin beta-10.
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5026
References	1   Takafuji V.A., Sharova L.V., Crisman M.V., Howard R.D.; "Equus caballus thymosin, beta 10 (TMSB10) mRNA."; Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases. 2   Hoerger S., Gallert B., Kellerman J., Voelter W.; "Isolation and structural identification of beta-thymosins from equinetissue: development of a specific ELISA against thymosin beta-10(TBeta-10)."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.749-750, Escom Science Publishers, Leiden (1993).
Domain Name	Thymosin
Hormone Name	Thymosin beta-10
Mature Hormone Sequence	ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	100033928
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	11057
Swiss-prot Accession number	P62327 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Hoerger S., Gallert B., Kellerman J., Voelter W.; "Isolation and structural identification of beta-thymosins from equinetissue: development of a specific ELISA against thymosin beta-10(TBeta-10)."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.749-750, Escom Science Publishers, Leiden (1993). 2   Takafuji V.A., Crisman M.V., Seat K.L., Sharova L.V., Ward D.L.,Howard R.D.; "Expression analysis of equine interleukin-1b treated equine synoviumusing suppression subtractive hybridization analysis (SSH-PCR)."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	11058
Swiss-prot Accession number	P62327 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Seraspenide inhibits the entry of hematopoeitic pluripotent stem cells into the S-phase
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Hoerger S., Gallert B., Kellerman J., Voelter W.; "Isolation and structural identification of beta-thymosins from equinetissue: development of a specific ELISA against thymosin beta-10(TBeta-10)."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.749-750, Escom Science Publishers, Leiden (1993). 2   Takafuji V.A., Crisman M.V., Seat K.L., Sharova L.V., Ward D.L.,Howard R.D.; "Expression analysis of equine interleukin-1b treated equine synoviumusing suppression subtractive hybridization analysis (SSH-PCR)."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
Domain Name	Thymosin
Hormone Name	Hematopoietic system regulatory peptide
Mature Hormone Sequence	SDKP
Position of mature hormone in Pre-Hormone protein	4 Residues from position (2-5)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	11150
Swiss-prot Accession number	P55885 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	107 Amino acids
Molecular weight	11884
References	1  PubMed abstract 9716385
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	QLGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	34 Residues from position (62-95)
Receptor	N/A
Gene ID	100034214
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	11151
Swiss-prot Accession number	P55885 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	107 Amino acids
Molecular weight	11884
References	1  PubMed abstract 9716385
Domain Name	Gastrin
Hormone Name	Gastrin
Mature Hormone Sequence	QGPWLEKEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	17 Residues from position (79-95)
Receptor	N/A
Gene ID	100034214
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	11217
Swiss-prot Accession number	P22969 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20721
References	1   Min K., Shiota K., Ogawa T.; "Molecular cloning of equine preprorelaxin cDNA."; J. Reprod. Dev. 42:171-178(1996). 2  PubMed abstract 7543295 3  PubMed abstract 2055195
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QKPDDVIKACGRELARLRIEICGSLSWK
Position of mature hormone in Pre-Hormone protein	28 Residues from position (26-53)
Receptor	N/A
Gene ID	100033823
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	11218
Swiss-prot Accession number	P22969 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20721
References	1   Min K., Shiota K., Ogawa T.; "Molecular cloning of equine preprorelaxin cDNA."; J. Reprod. Dev. 42:171-178(1996). 2  PubMed abstract 7543295 3  PubMed abstract 2055195
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	QLSHKCCYWGCTRKELARQC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (163-182)
Receptor	N/A
Gene ID	100033823
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11304
Swiss-prot Accession number	P01220 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13809
References	1   Min K., Shinozaki M., Miyazawa K., Nishimura R., Sasaki N., Shiota K.,Ogawa T.; "Nucleotide sequence of eCG alpha-subunit cDNA and its expression inthe equine placenta."; J. Reprod. Dev. 40:301-305(1994). 2  PubMed abstract 3437252 3   Moore W.T. Jr., Ward D.N., Burleigh B.D.; "Primary structure of pregnant mare serum gonadotropin alphasubunit."; Fed. Proc. 38:462-462(1979). 4  PubMed abstract 670201 5   Min K., Shinozaki M., Miyazawa K., Nishimura R., Sasaki N., Shiota K.,Ogawa T.; "Nucleotide sequence of eCG alpha-subunit cDNA and its expression inthe equine placenta."; J. Reprod. Dev. 40:301-305(1994). 6  PubMed abstract 3437252 7   Moore W.T. Jr., Ward D.N., Burleigh B.D.; "Primary structure of pregnant mare serum gonadotropin alphasubunit."; Fed. Proc. 38:462-462(1979). 8  PubMed abstract 670201
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFTTQDCPECKLRENKYFFKLGVPIYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYHHKI
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	P47799    Detail in HMRbase
Gene ID	100034174
PDB ID	N/A
Drugpedia	wiki
Comments